ZFP14 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP179388

Catalog No. NBP179388

Description

ZFP14 Polyclonal specifically detects ZFP14 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: ZFP14
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: KIAA1559, zfp-14, zinc finger protein 14 homolog, zinc finger protein 14 homolog (mouse), zinc finger protein 531, ZNF531
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 57677
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_065968
• Gene Symbols: ZFP14
• Immunogen: Synthetic peptide directed towards the N terminal of human ZFP14The immunogen for this antibody is ZFP14. Peptide sequence KSYSLQGSIFRNDWECKSKIEGEKEQQEGYFGQVKITSEKMTTYKRHNFL.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Human: 100%; Equine: 85%.
• Target Species: Human, Rat, Canine, Equine
• Isotype: IgG