Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ZFP14 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP17938820UL
Description
ZFP14 Polyclonal specifically detects ZFP14 in Human samples. It is validated for Western Blot.Specifications
| ZFP14 | |
| Polyclonal | |
| Western Blot 1:1000 | |
| NP_065968 | |
| ZFP14 | |
| Synthetic peptide directed towards the N terminal of human ZFP14The immunogen for this antibody is ZFP14. Peptide sequence KSYSLQGSIFRNDWECKSKIEGEKEQQEGYFGQVKITSEKMTTYKRHNFL. | |
| 20 μL | |
| Primary | |
| Human | |
| IgG |
| Western Blot | |
| Unconjugated | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| KIAA1559, zfp-14, zinc finger protein 14 homolog, zinc finger protein 14 homolog (mouse), zinc finger protein 531, ZNF531 | |
| Rabbit | |
| Affinity Purified | |
| RUO | |
| 57677 | |
| Store at -20C. Avoid freeze-thaw cycles. |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction