Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ZFP200 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | ZFP200 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
ZFP200 Polyclonal specifically detects ZFP200 in Human samples. It is validated for Western Blot.Specifications
ZFP200 | |
Polyclonal | |
Rabbit | |
NP_003445 | |
7752 | |
Synthetic peptide directed towards the middle region of human ZNF200. Peptide sequence SRHEGIHIREKIFKCPECGKTFPKNEEFVLHLQSHEAERPYGCKKCGRRF. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
MGC45293, zinc finger protein 200, ZNFMF | |
ZNF200 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title