Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Invitrogen™ Zfp566 Polyclonal Antibody
Rabbit Polyclonal Antibody
Supplier: Invitrogen™ PA570376
Description
This target displays homology in the following species: Cow: 93%; Dog: 93%; Guinea Pig: 86%; Horse: 100%; Human: 100%; Mouse: 100%; Pig: 93%; Rabbit: 93%; Rat: 100%; Zebrafish: 93%.
Zfp566 gene ontology annotations related to this gene include regulation of transcription, DNA-templated.
Specifications
Zfp566 | |
Polyclonal | |
Unconjugated | |
Zfp566 | |
2700043M03Rik; mszf4; RGD1563239; Zfp566; zinc finger protein 566 | |
Rabbit | |
Affinity chromatography | |
RUO | |
502316 | |
-20°C, Avoid Freeze/Thaw Cycles | |
Liquid |
Western Blot | |
0.5 mg/mL | |
PBS with 2% sucrose and 0.09% sodium azide | |
0 | |
Zfp566 | |
synthetic peptide directed towards the following sequence YECKECGKAFSSGSNFTQHQRIHTGEKPYECKECGNAFSQSSQLIKHQRI. | |
100 μL | |
Primary | |
Rat | |
Antibody | |
IgG |
Safety and Handling
WARNING: Cancer - www.P65Warnings.ca.gov
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction