Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ZFP90 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | ZFP90 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
ZFP90 Polyclonal specifically detects ZFP90 in Human samples. It is validated for Western Blot.Specifications
ZFP90 | |
Polyclonal | |
Rabbit | |
NP_597715 | |
146198 | |
Synthetic peptide directed towards the middle region of human ZFP90The immunogen for this antibody is ZFP90. Peptide sequence SSLVQHQRIHTGEKPYRCNLCGRSFRHGTSLTQHEVTHSGEKPFQCKECG. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
KIAA1954, NK10, zfp-90, zinc finger protein 476, zinc finger protein 756, zinc finger protein 90 homolog, zinc finger protein 90 homolog (mouse), ZNF756 | |
ZFP90 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title