Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ZFP95 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$487.50
Specifications
| Antigen | ZFP95 |
|---|---|
| Dilution | Western Blot 1.0 ug/ml |
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
Description
ZFP95 Polyclonal specifically detects ZFP95 in Human samples. It is validated for Western Blot.Specifications
| ZFP95 | |
| Western Blot | |
| Unconjugated | |
| Rabbit | |
| Human | |
| FLJ39233, KIAA1015, MGC33710, zfp-95, ZFP95, Zinc finger protein 95 homolog, zinc finger protein 95 homolog (mouse), zinc finger protein homologous to Zfp95 in mouse, zinc finger protein with KRAB and SCAN domains 5, zinc finger with KRAB and SCAN domains 5, ZNF914 | |
| The immunogen is a synthetic peptide directed towards the N terminal region of human ZFP95 (NP_055384). Peptide sequence VKIEEVADVAVSFILEEWGHLDQSQKSLYRDDRKENYGSITSMGYESRDN | |
| Affinity purified |
| Western Blot 1.0 ug/ml | |
| Polyclonal | |
| Purified | |
| RUO | |
| PBS buffer, 2% sucrose | |
| 23660 | |
| Primary | |
| Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title