ZGPAT Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP156562

Catalog No. NBP156562

Description

ZGPAT Polyclonal specifically detects ZGPAT in Human samples. It is validated for Western Blot.

Specifications

• Antigen: ZGPAT
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: GPATC6G patch domain-containing protein 6, GPATCH6Zinc finger and G patch domain-containing protein, KIAA1847Zinc finger CCCH domain-containing protein 9, MGC44880, ZC3H9FLJ14972, ZC3HDC9dJ583P15.3, zinc finger, CCCH-type with G patch domain, ZIPzinc finger CCCH-type with G patch domain-containing protein
• Host Species: Rabbit
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 84619
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: Q8N5A5
• Gene Symbols: ZGPAT
• Immunogen: Synthetic peptides corresponding to ZGPAT(zinc finger, CCCH-type with G patch domain) The peptide sequence was selected from the C terminal of ZGPAT. Peptide sequence AGRHSVASAQLQEKLAGAQRQLGQLRAQEAGLQQEQRKADTHKKMTEF.
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Expected identity based on immunogen sequence: Equine: 100%; Human: 100%; Bovine: 92%; Guinea pig: 92%; Sheep: 92%; Mouse: 78%; Rabbit: 78%; Rat: 78%.
• Target Species: Human, Mouse, Rat, Bovine, Canine, Equine, Guinea Pig, Rabbit, Sheep
• Isotype: IgG