Novus Biologicals™ Zhangfei Recombinant Protein Antigen

Description

Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition

A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Zhangfei. Source: E.coli Amino Acid Sequence: TTSLFRDSPAGDHDYALPVGKQKQDLLEEDDSAGGVCLHVDKDKVSVEFCSACARKASSSL The Zhangfei Recombinant Protein Antigen is derived from E. coli. The Zhangfei Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.

Specifications

• Gene ID (Entrez): 58487
• Purification Method: >80% by SDS-PAGE and Coomassie blue staining
• Common Name: Zhangfei Recombinant Protein Antigen
• Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
• Formulation: PBS and 1M Urea, pH 7.4
• For Use With (Application): Blocking/Neutralizing, Control
• Gene Alias: CREB/ATF bZIP transcription factor, FLJ94018, HCF-binding transcription factor Zhangfei, Host cell factor-binding transcription factor Zhangfei, SHP-interacting leucine zipper protein, SMILE, Zhangfei
• Gene Symbol: CREBZF
• Label Type: Unlabeled
• Product Type: Recombinant Protein Antigen
• Quantity: 100 μL
• Regulatory Status: RUO
• Research Category: DNA replication Transcription Translation and Splicing
• Source: E.coli
• Specific Reactivity: Human

For research use only.