Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ZHX2 Rabbit anti-Mouse, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | ZHX2 |
---|---|
Dilution | Western Blot 1.0 ug/ml |
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
ZHX2 Polyclonal specifically detects ZHX2 in Mouse samples. It is validated for Western Blot.Specifications
ZHX2 | |
Western Blot | |
Unconjugated | |
Rabbit | |
Apoptosis, Cancer, Tumor Suppressors | |
PBS buffer, 2% sucrose | |
22882 | |
Primary | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot 1.0 ug/ml | |
Polyclonal | |
Purified | |
RUO | |
Mouse | |
Zona pellucida glycoprotein 2, zona pellucida glycoprotein 2 (sperm receptor), zona pellucida glycoprotein ZP2, Zona pellucida protein A, zona pellucida sperm-binding protein 2, Zp-2, ZPA | |
The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse ZHX2 (NP_955520). Peptide sequence RGRDAVSRKVAKQVAESPKNGSEAAHQYAKDPKALSEEDSEKLVPRMKVG | |
Affinity purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title