Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ZIC4 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | ZIC4 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
ZIC4 Polyclonal specifically detects ZIC4 in Human samples. It is validated for Western Blot.Specifications
ZIC4 | |
Polyclonal | |
Rabbit | |
NP_115529 | |
84107 | |
Synthetic peptide directed towards the middle region of human ZIC4. Peptide sequence RKKHSHVHTSDKPYTCKVRGCDKCYTHPSSLRKHMKVHGRSPPPSSGYDS. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
FLJ42609, FLJ45833, Zic family member 4, Zinc finger protein of the cerebellum 4zinc family member 4 protein HZIC4, zinc finger protein ZIC 4 | |
ZIC4 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title