ZMIZ1/Zimp10 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP192610

Catalog No. NBP192610

Description

ZMIZ1/Zimp10 Polyclonal specifically detects ZMIZ1/Zimp10 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.

Specifications

• Antigen: ZMIZ1/Zimp10
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200
• Gene Alias: FLJ13541, hZIMP10, KIAA1224Zimp10, MIZ, PIAS-like protein Zimp10, RAI17TRAFIP10, retinoic acid induced 17, Retinoic acid-induced protein 17, RP11-519K18.1, ZIMP10FLJ00092 protein, zinc finger MIZ domain-containing protein 1, zinc finger, MIZ-type containing 1, zinc finger-containing, Miz1, PIAS-like protein on chromosome 10
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Gene ID (Entrez): 57178
• Target Species: Human
• Isotype: IgG

• Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Symbols: ZMIZ1
• Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:MNSMDRHIQQTNDRLQCIKQHLQNPANFHNAATELLDWCGDPRAFQRPFEQSLMGCLTVVSRVAAQQGFDLDLGYRLLAVCAANRDKFT
• Quantity: 0.1 mL
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only