Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ZMYND19 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$382.00 - $610.00
Specifications
Antigen | ZMYND19 |
---|---|
Dilution | Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:1000-1:2500 |
Applications | Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Description
ZMYND19 Polyclonal specifically detects ZMYND19 in Human samples. It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.Specifications
ZMYND19 | |
Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin) | |
Unconjugated | |
RUO | |
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide | |
116225 | |
This antibody was developed against Recombinant Protein corresponding to amino acids:MTDFKLGIVRLGRVAGKTKYTLIDEQDIPLVESYSFEARMEVDADGNGAKIFAYAFDKNRGRGSGRLLHELLWERH | |
Primary | |
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles. |
Immunohistochemistry 1:10-1:500, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:1000-1:2500 | |
Polyclonal | |
Rabbit | |
Human | |
MCH-R1-interacting zinc finger protein, Melanin-concentrating hormone receptor 1-interacting zinc finger protein, MIZIPmelanin-concentrating hormone receptor 1 interacting zinc-finger protein, RP11-48C7.4, zinc finger MYND domain-containing protein 19, zinc finger, MYND domain containing 19, zinc finger, MYND-type containing 19 | |
ZMYND19 | |
IgG | |
Affinity Purified | |
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. |
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title