Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ZNF17 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | ZNF17 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
ZNF17 Polyclonal specifically detects ZNF17 in Human samples. It is validated for Western Blot.Specifications
ZNF17 | |
Polyclonal | |
Rabbit | |
NP_008890 | |
7565 | |
Synthetic peptide directed towards the N terminal of human ZNF17. Peptide sequence TEDYMVFEDVAIHFSQEEWGILNDVQRHLHSDVMLENFALLSSVGCWHGA. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
FLJ40864, FLJ46058, FLJ46615, HPF3, KIAA1947, KOX10, zinc finger protein 17, zinc finger protein 17 (HPF3, KOX 10), zinc finger protein HPF3, zinc finger protein KOX10 | |
ZNF17 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title