Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ZNF185 Antibody, Novus Biologicals™
SDP

Rabbit Polyclonal Antibody

$206.00 - $487.50

Specifications

Antigen ZNF185
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP18032020
SDP
View Documents
Novus Biologicals
NBP18032020UL
20 μL
Each for $206.00
Only null left
Add to Cart
 
NBP180320
SDP
View Documents
Novus Biologicals
NBP180320
100 μL
Each for $487.50
Only null left
Add to Cart
 
Description

Description

ZNF185 Polyclonal specifically detects ZNF185 in Human samples. It is validated for Western Blot.
Specifications

Specifications

ZNF185
Polyclonal
Rabbit
NP_009081
7739
Synthetic peptide directed towards the N terminal of human ZNF185. Peptide sequence LAPYNIRRSSTSGDTEEEEEEEVVPFSSDEQKRRSEAASGVLRRTAPREH.
Primary
Western Blot
Unconjugated
RUO
zinc finger protein 185 (LIM domain)
ZNF185
IgG
Videos
SDS
Documents

Documents

Product Certifications
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Your feedback has been submitted: Thank you for helping us improve our website.