Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

NLRP3/NALP3 Antibody (Nalpy3-b) - BSA Free, Novus Biologicals™
SDP

Catalog No. p-7110226 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP191413 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP191413 Supplier Novus Biologicals Supplier No. NBP191413

Rabbit Polyclonal Antibody

ZNF192P1 Polyclonal specifically detects ZNF192P1 in Human samples. It is validated for Western Blot.

Specifications

Antigen ZNF192P1
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Alias dJ265C24.4, ZNF192P1 zinc finger protein 192 pseudogene 1, ZNF389, ZNF389P
Gene Symbols ZNF389
Host Species Rabbit
Immunogen Synthetic peptide directed towards the N terminal of human ZNF389. Peptide sequence MDPHQKVPSIYNGDTLQTPEYEKVSQYEDQLERHEGRHMEERRYKCNECG.
Molecular Weight of Antigen 31 kDa
Purification Method Affinity Purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 651302
Test Specificity Expected identity based on immunogen sequence: Pig: 92% Bovine 82%.
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Pig, Bovine
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.