Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ZNF226 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | ZNF226 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
ZNF226 Polyclonal specifically detects ZNF226 in Human samples. It is validated for Western Blot.Specifications
ZNF226 | |
Polyclonal | |
Rabbit | |
NP_001027544 | |
7769 | |
Synthetic peptide directed towards the C terminal of human ZNF226The immunogen for this antibody is ZNF226. Peptide sequence KSFGRSAHLQAHQKVHTGDKPYKCDECGKGFKWSLNLDMHQRVHTGEKPY. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
KIAA0972MGC33740, zinc finger protein 510 | |
ZNF226 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title