Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. NLRP3/NALP3 Antibody (Nalpy3-b) - BSA Free, Novus Biologicals™

NLRP3/NALP3 Antibody (Nalpy3-b) - BSA Free, Novus Biologicals™
SDP

Catalog No. p-7110312 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP191519 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NBP191519 Supplier Novus Biologicals Supplier No. NBP191519

Description

Rabbit Polyclonal Antibody

ZNF252 Polyclonal specifically detects ZNF252 in Human samples. It is validated for Western Blot.

Specifications

Antigen ZNF252
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1.0 ug/ml
Formulation PBS & 2% Sucrose. with 0.09% Sodium Azide
Gene Alias ZNF252P zinc finger protein 252, pseudogene
Gene Symbols ZNF252
Host Species Rabbit
Immunogen Synthetic peptide directed towards the middle region of human ZNF252. Peptide sequence QRIHTGEKPYECNECAKSFSLNRTLTVHQRIHTGEKPYRCNECGKSFSQCS.
Molecular Weight of Antigen 75 kDa
Purification Method Affinity Purified
Quantity 100 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 286101
Reconstitution Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
Target Species Human, Canine, Equine
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.