Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ZNF254 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | ZNF254 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP180111
|
Novus Biologicals
NBP180111 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
ZNF254 Polyclonal specifically detects ZNF254 in Human samples. It is validated for Western Blot.Specifications
| ZNF254 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| 9534 | |
| Synthetic peptide directed towards the middle region of human ZNF254. Peptide sequence SKVFQCDKYLKVFYKFLNSNRPKIRHTEKKSFKCKKRVKLFCMLSHKTQH. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| BA526D8.4, FLJ33884, KRAB box containing C2H2 type zinc finger bA526D8.4, MGC133033, MGC133034, zinc finger protein 484 | |
| ZNF254 | |
| IgG | |
| Affinity Purified | |
| 42 kDa |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title