Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ZNF286 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | ZNF286 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Form | Purified |
Description
ZNF286 Polyclonal specifically detects ZNF286 in Human samples. It is validated for Western Blot.Specifications
ZNF286 | |
Polyclonal | |
Purified | |
RUO | |
MGC149627, zinc finger protein 286, zinc finger protein 286A | |
ZNF286A | |
IgG | |
Protein A purified |
Western Blot | |
Unconjugated | |
Rabbit | |
NP_065703 | |
57335 | |
Synthetic peptide directed towards the C terminal of human ZNF286. Peptide sequence GKAFIHSSALIQHQRTHTGEKPFRCNECGKSFKCSSSLIRHQRVHTEEQP. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title