Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ZNF30 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$480.74
Specifications
| Antigen | ZNF30 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
ZNF30 Polyclonal specifically detects ZNF30 in Human samples. It is validated for Western Blot.Specifications
| ZNF30 | |
| Polyclonal | |
| Rabbit | |
| NP_919306 | |
| 90075 | |
| Synthetic peptide directed towards the middle region of human ZNF30. Peptide sequence YECKECGKAFSTSSPLAKHQRIHTGEKPYECKECGKSFTVYGQLTRHQSI. | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| DKFZp686N19164, FLJ20562, KOX28, zinc finger protein 30, zinc finger protein 30 (KOX 28), zinc finger protein KOX28 | |
| ZNF30 | |
| IgG | |
| 71 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title