Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ZNF300 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | ZNF300 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
ZNF300 Polyclonal specifically detects ZNF300 in Human samples. It is validated for Western Blot.Specifications
ZNF300 | |
Polyclonal | |
Rabbit | |
NP_443092 | |
91975 | |
Synthetic peptide directed towards the N terminal of human ZNF300. Peptide sequence DISNWIYPDEYQADGRQDRKSNLHNSQSCILGTVSFHHKILKGVTRDGSL. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
kruppel-like zinc finger protein, zinc finger protein 300 | |
ZNF300 | |
IgG | |
69 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title