Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ZNF318 Rabbit anti-Human, Polyclonal, Novus Biologicals™

Rabbit Polyclonal Antibody
Supplier: Novus Biologicals NBP310946100UL
Description
ZNF318 Polyclonal specifically detects ZNF318 in Human samples. It is validated for Western Blot, Immunohistochemistry.Specifications
ZNF318 | |
Polyclonal | |
Western Blot 1.0 ug/ml, Immunohistochemistry | |
Zinc finger and SCAN domain-containing protein 15, zinc finger protein 397, Zinc finger protein 47ZSCAN15MGC13250, ZNF47 | |
The immunogen is a synthetic peptide directed towards the N terminal region of human ZNF318 (NP_055160). Peptide sequence SVFTRSSQCSRGLERYISQEEGPLSPFLGQLDEDYRTKETFLHRSDYSPH | |
100 μg | |
Chromatin Research | |
24149 | |
Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles. |
Western Blot, Immunohistochemistry | |
Unconjugated | |
PBS buffer, 2% sucrose | |
Rabbit | |
Affinity purified | |
RUO | |
Primary | |
Human | |
Purified |
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title
Spot an opportunity for improvement?Share a Content Correction