ZNF32 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP25501225UL

Catalog No. NB395219

Description

ZNF32 Polyclonal specifically detects ZNF32 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.

Specifications

• Antigen: ZNF32
• Classification: Polyclonal
• Dilution: Immunocytochemistry/Immunofluorescence 1 - 4 μg/mL
• Gene Alias: Zinc finger and SCAN domain-containing protein 14, zinc finger protein 396, ZSCAN14FLJ31213
• Host Species: Rabbit
• Purification Method: Affinity Purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze/thaw cycles.

• Applications: Immunocytochemistry, Immunofluorescence
• Conjugate: Unconjugated
• Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
• Gene Symbols: ZNF32
• Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LLDCHGRYAQNVAFFNVMTEAHHKYDHSEATGSSSWDIQNSFRREKLEQKSPDSKTLQEDSPGVRQRVYECQEC
• Quantity: 25 μL
• Research Discipline: DNA replication Transcription Translation and Splicing
• Gene ID (Entrez): 7580
• Target Species: Human
• Isotype: IgG

For Research Use Only