Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
Novus Biologicals™ ZNF34 Recombinant Protein Antigen
Highly purified. Generating reliable and reproducible results. Applications: Antibody Competition
Supplier: Novus Biologicals™ NBP257482PEP
Description
A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ZNF34. Source: E.coli Amino Acid Sequence: LSRPVPDQRPHKCDICEQSFEQRSYLNNHTRVHRS The ZNF34 Recombinant Protein Antigen is derived from E. coli. The ZNF34 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.Specifications
| 80778 | |
| ZNF34 Recombinant Protein Antigen | |
| PBS and 1M Urea, pH 7.4. | |
| FLJ3472, KOX21zinc finger protein 37a (KOX 21), zinc finger protein 37A, Zinc finger protein KOX21, ZNF37 | |
| Unlabeled | |
| 100μL | |
| E.coli |
| >80% by SDS-PAGE and Coomassie blue staining | |
| Store at −20°C. Avoid freeze-thaw cycles. | |
| Blocking/Neutralizing, Control | |
| ZNF34 | |
| Recombinant Protein Antigen | |
| RUO | |
| This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52968. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title
For Research Use Only.
Spot an opportunity for improvement?
Provide Content Correction