Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ZNF365 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
| Antigen | ZNF365 |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP17999920
|
Novus Biologicals
NBP17999920UL |
20 μL |
Each for $206.00
|
|
|||||
|
NBP179999
|
Novus Biologicals
NBP179999 |
100 μL |
Each for $487.50
|
|
|||||
Description
ZNF365 Polyclonal specifically detects ZNF365 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| ZNF365 | |
| Polyclonal | |
| Rabbit | |
| NP_955522 | |
| 22891 | |
| Synthetic peptide directed towards the N terminal of human ZNF365. Peptide sequence DHTRFRSLSSLRAHLEFSHSYEERTLLTKCSLFPSLKDTDLVTSSELLKP. | |
| Primary |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| RUO | |
| DKFZp547M223, double-stranded RNA-binding zinc finger protein JAZ, JAZZfp346, Just another zinc finger protein, zinc finger protein 346 | |
| ZNF365 | |
| IgG | |
| 36 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title