Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ZNF485 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$158.00 - $499.50
Specifications
| Antigen | ZNF485 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP18040020
|
Novus Biologicals
NBP18040020UL |
20 μL |
Each for $158.00
|
|
|||||
|
NBP180400
|
Novus Biologicals
NBP180400 |
100 μL |
Each for $499.50
|
|
|||||
Description
ZNF485 Polyclonal specifically detects ZNF485 in Human samples. It is validated for Western Blot.Specifications
| ZNF485 | |
| Polyclonal | |
| Rabbit | |
| NP_660355 | |
| 220992 | |
| Synthetic peptide directed towards the C terminal of human ZNF485. Peptide sequence: RHSSGLVEHQRLHTGEKPYKCNECGKAFPRSSALKQHKKIHNKERAMKCS | |
| Primary |
| Western Blot | |
| Unconjugated | |
| RUO | |
| zinc finger protein 227 | |
| ZNF485 | |
| IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title