Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ZNF502 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$487.50

Specifications

Antigen	ZNF502
Applications	Western Blot
Classification	Polyclonal
Conjugate	Unconjugated
Host Species	Rabbit

View More Specs

Products 1

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP180130 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP180130	100 μL	Each of 1 for $487.50	Only null left	Already have an account? Sign In to view your price. New here? Register with us today! Add to Cart

Description

ZNF502 Polyclonal specifically detects ZNF502 in Human samples. It is validated for Western Blot.

Specifications

Antigen	ZNF502
Classification	Polyclonal
Host Species	Rabbit
Gene Accession No.	NP_149987
Gene ID (Entrez)	91392
Immunogen	Synthetic peptide directed towards the N terminal of human ZNF502. Peptide sequence IDSSGIVVKRFQEDEYQDSTFEEKYACEGMKENSPREIAESCLFQEGGFG.
Primary or Secondary	Primary

Applications	Western Blot
Conjugate	Unconjugated
Regulatory Status	RUO
Gene Alias	KOX17Zinc finger protein 191, lacks zinc finger domain, Retinoic acid suppression protein A, RSG-A, Zfp191, Zinc finger and SCAN domain-containing protein 3, zinc finger protein 24, zinc finger protein 24 (KOX 17), ZNF191, ZSCAN3Zinc finger protein KOX17
Gene Symbols	ZNF502
Isotype	IgG
Molecular Weight of Antigen	63 kDa

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

ZNF502 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents