Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ZNF527 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | ZNF527 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Form | Purified |
Description
ZNF527 Polyclonal specifically detects ZNF527 in Human samples. It is validated for Western Blot.Specifications
ZNF527 | |
Polyclonal | |
Purified | |
RUO | |
84503 | |
Synthetic peptide directed towards the C terminal of human ZNF527. Peptide sequence GKAFHQILSLRLHQRIHAGEKPYKCNECGNNFSCVSALRRHQRIHNRETL. | |
Primary |
Western Blot | |
Unconjugated | |
Rabbit | |
KIAA1829, zinc finger protein 527 | |
ZNF527 | |
IgG | |
Protein A purified |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title