Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ZNF546 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | ZNF546 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
ZNF546 Polyclonal specifically detects ZNF546 in Human samples. It is validated for Western Blot.Specifications
ZNF546 | |
Polyclonal | |
Rabbit | |
Human | |
MGC43537, zinc finger protein 49, zinc finger protein 546, ZNF49 | |
ZNF546 | |
IgG | |
98 kDa |
Western Blot | |
Unconjugated | |
RUO | |
NP_848639 | |
339327 | |
Synthetic peptide directed towards the N terminal of human ZNF546. Peptide sequence LSEKNVCKIYLSQLQTGEKSKNTIHEDTIFRNGLQCKHEFERQERHQMGC. | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title