Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ZNF551 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

$487.50

Specifications

Antigen	ZNF551
Applications	Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Classification	Polyclonal
Conjugate	Unconjugated
Form	Purified

View More Specs

Products 1

Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
Catalog Number	Mfr. No.	Quantity	Price	Quantity & Availability
NBP180139 View Documents View Product Certificates View Alternatives and Save Up to	Novus Biologicals NBP180139	100 μL	Each of 1 for $487.50	Only null left	Sign In or Register to check your price. Add to Cart

Description

ZNF551 Polyclonal specifically detects ZNF551 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

Antigen	ZNF551
Classification	Polyclonal
Form	Purified
Regulatory Status	RUO
Gene Accession No.	BAC03625
Gene ID (Entrez)	90233
Immunogen	Synthetic peptide directed towards the N terminal of human ZNF551. Peptide sequence FVTGCRFHVLNYFTCGEAFPAPTDLLQHEATPSGEEPHSSSSKHIQAFFN.
Primary or Secondary	Primary
Molecular Weight of Antigen	40 kDa

Applications	Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate	Unconjugated
Host Species	Rabbit
Target Species	Human
Gene Alias	DKFZp686H1038, KOX 23 protein (56 AA), KOX23, MGC52307, zinc finger protein 551, zinc finger protein KOX23
Gene Symbols	ZNF551
Isotype	IgG
Purification Method	Protein A purified

Spot an opportunity for improvement?Share a Content Correction

Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

Your Name

Email Address *

Type of Issue *

Detailed Description of Issue/Request *

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Cancel Submit

Your feedback has been submitted: Thank you for helping us improve our website.

ZNF551 Antibody, Novus Biologicals™

Specifications

Description

Specifications

Documents