Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ZNF555 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$206.00 - $487.50
Specifications
Antigen | ZNF555 |
---|---|
Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP18016720
![]() |
Novus Biologicals
NBP18016720UL |
20 μL |
Each for $206.00
|
|
|||||
NBP180167
![]() |
Novus Biologicals
NBP180167 |
100 μL |
Each for $487.50
|
|
|||||
Description
ZNF555 Polyclonal specifically detects ZNF555 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
ZNF555 | |
Polyclonal | |
Rabbit | |
NP_690004 | |
148254 | |
Synthetic peptide directed towards the N terminal of human ZNF555. Peptide sequence PHLNLYKKIPPGVKQYEYNTYGKVFMHRRTSLKSPITVHTGHKPYQCQEC. | |
Primary |
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
Unconjugated | |
RUO | |
FLJ41894, MGC26707, zinc finger protein 555 | |
ZNF555 | |
IgG | |
73 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title