ZNF560 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP180161

Catalog No. NBP180161

Description

ZNF560 Polyclonal specifically detects ZNF560 in Human samples. It is validated for Western Blot.

Specifications

• Antigen: ZNF560
• Classification: Polyclonal
• Conjugate: Unconjugated
• Formulation: PBS, 2% Sucrose with 0.09% Sodium Azide
• Gene Alias: FLJ31986, MGC119490, MGC119493, zinc finger protein 560
• Host Species: Rabbit
• Molecular Weight of Antigen: 91 kDa
• Quantity: 100 μL
• Primary or Secondary: Primary
• Test Specificity: Rabbit: 79%.
• Target Species: Human, Rabbit
• Isotype: IgG

• Applications: Western Blot
• Concentration: 0.5 mg/ml
• Dilution: Western Blot 1.0 ug/ml
• Gene Accession No.: NP_689689
• Gene Symbols: ZNF560
• Immunogen: Synthetic peptide directed towards the middle region of human ZNF560. Peptide sequence TQDKSFEGTDYGKAFIYQSYLEAHRKTQSGEKLNEWKQCGEAFTHSTSHA.
• Purification Method: Affinity purified
• Regulatory Status: RUO
• Gene ID (Entrez): 147741
• Reconstitution: Centrifuge the vial of lyoph antibody at 12,000 x g for 20 seconds. Add 50μL of distilled water. Vortex followed by centrifuge again to pellet the solution.Final concentration is 1mg/mL in PBS buffer.
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.