Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More

ZNF567 Antibody, Novus Biologicals™
SDP

Rabbit Polyclonal Antibody

$206.00 - $487.50

Specifications

Antigen ZNF567
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Host Species Rabbit
View More Specs

Products 2
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
Catalog Number Mfr. No. Quantity Price Quantity & Availability  
NBP1804220
SDP
View Documents
Novus Biologicals
NBP18041220UL
20 μL
Each for $206.00
Only null left
Add to Cart
 
NBP180412
SDP
View Documents
Novus Biologicals
NBP180412
100 μL
Each for $487.50
Only null left
Add to Cart
 
Description

Description

ZNF567 Polyclonal specifically detects ZNF567 in Human samples. It is validated for Western Blot.
Specifications

Specifications

ZNF567
Polyclonal
Rabbit
NP_689816
163081
Synthetic peptide directed towards the N terminal of human ZNF567. Peptide sequence TSFAGHTCLEENWKAEDFLVKFKEHQEKYSRSVVSINHKKLVKEKSKIYE.
Primary
Western Blot
Unconjugated
RUO
MGC45586, zinc finger protein 567
ZNF567
IgG
Videos
SDS
Documents

Documents

Product Certifications
Product Content Correction

Your input is important to us. Please complete this form to provide feedback related to the content on this product.

Product Title

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.

Your feedback has been submitted: Thank you for helping us improve our website.