Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ZNF582 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$158.00 - $487.50
Specifications
Antigen | ZNF582 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP18014220
![]() |
Novus Biologicals
NBP18014220UL |
20 μL |
Each for $158.00
|
|
|||||
NBP180142
![]() |
Novus Biologicals
NBP180142 |
100 μL |
Each for $487.50
|
|
|||||
Description
ZNF582 Polyclonal specifically detects ZNF582 in Human samples. It is validated for Western Blot.Specifications
ZNF582 | |
Polyclonal | |
Rabbit | |
NP_653291 | |
147948 | |
Synthetic peptide directed towards the N terminal of human ZNF582. Peptide sequence SGGLCPVLESRYDTKELFPKQHVYEVESPQWEIMESLTSYGLECSSFQDD. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
FLJ30927, zinc finger protein 582 | |
ZNF582 | |
IgG | |
60 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title