Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ZNF610 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | ZNF610 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
ZNF610 Polyclonal specifically detects ZNF610 in Human samples. It is validated for Western Blot.Specifications
ZNF610 | |
Polyclonal | |
Rabbit | |
Human | |
DKFZp547A1010, FLJ36040, MGC102679, zinc finger protein 610, zink finger protein | |
ZNF610 | |
IgG | |
53 kDa |
Western Blot | |
Unconjugated | |
RUO | |
NP_775801 | |
162963 | |
Synthetic peptide directed towards the N terminal of human ZNF610. Peptide sequence: LSIISMLKQRREPLILQSQVKIVKNTDGRECVRSVNTGRSCVLGSNAENK | |
Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title