Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ZNF621 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | ZNF621 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Form | Purified |
Description
ZNF621 Polyclonal specifically detects ZNF621 in Human samples. It is validated for Western Blot.Specifications
ZNF621 | |
Polyclonal | |
Purified | |
RUO | |
DKFZp686B11107, FLJ23786, FLJ45246, MGC126668, zinc finger protein 621 | |
ZNF621 | |
IgG | |
Protein A purified |
Western Blot | |
Unconjugated | |
Rabbit | |
NP_940886 | |
285268 | |
Synthetic peptide directed towards the middle region of human ZNF621. Peptide sequence ECKECGKGLSSNTALTQHQRIHTGEKPYECKECGKAFRRSAAYLQHQRLH. | |
Primary | |
49 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title