Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ZNF676 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
| Antigen | ZNF676 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
Description
ZNF676 Polyclonal specifically detects ZNF676 in Human samples. It is validated for Western Blot.Specifications
| ZNF676 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| zinc finger protein 676 | |
| ZNF676 | |
| IgG |
| Western Blot | |
| Unconjugated | |
| RUO | |
| NP_001001411 | |
| 163223 | |
| Synthetic peptide directed towards the middle region of human ZNF676The immunogen for this antibody is ZNF676. Peptide sequence KPYKCEECGKGFSSVSTLNTHKAIHAEEKPYKCEECGKASNSSSKLMEHK. | |
| Primary |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title