Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ZNF677 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | ZNF677 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
ZNF677 Polyclonal specifically detects ZNF677 in Human samples. It is validated for Western Blot.Specifications
ZNF677 | |
Polyclonal | |
Rabbit | |
Q86XU0 | |
342926 | |
Synthetic peptides corresponding to ZNF677 (zinc finger protein 677) The peptide sequence was selected from the N terminal of ZNF677. Peptide sequence YRNLLSLDEDNIPPEDDISVGFTSKGLSPKENNKEELYHLVILERKESHG. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
MGC48625, zinc finger protein 677 | |
ZNF677 | |
IgG | |
68 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title