Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ZNF677 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | ZNF677 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP169213
|
Novus Biologicals
NBP169213 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
ZNF677 Polyclonal specifically detects ZNF677 in Human samples. It is validated for Western Blot.Specifications
| ZNF677 | |
| Polyclonal | |
| Rabbit | |
| Q86XU0 | |
| 342926 | |
| Synthetic peptides corresponding to ZNF677 (zinc finger protein 677) The peptide sequence was selected from the N terminal of ZNF677. Peptide sequence YRNLLSLDEDNIPPEDDISVGFTSKGLSPKENNKEELYHLVILERKESHG. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| MGC48625, zinc finger protein 677 | |
| ZNF677 | |
| IgG | |
| Affinity Purified | |
| 68 kDa |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title