Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ZNF683 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$158.00 - $487.50
Specifications
| Antigen | ZNF683 |
|---|---|
| Applications | Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Form | Purified |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP18018520
|
Novus Biologicals
NBP18018520UL |
20 μL |
Each for $158.00
|
|
|||||
|
NBP180185
|
Novus Biologicals
NBP180185 |
100 μL |
Each for $487.50
|
|
|||||
Description
ZNF683 Polyclonal specifically detects ZNF683 in Human samples. It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.Specifications
| ZNF683 | |
| Polyclonal | |
| Purified | |
| RUO | |
| NP_775845 | |
| ZNF683 | |
| IgG | |
| Protein A purified |
| Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin) | |
| Unconjugated | |
| Rabbit | |
| Human | |
| 257101 | |
| Synthetic peptide directed towards the N terminal of human ZNF683. Peptide sequence PAPLGTDLQGLQEDALSMKHEPPGLQASSTDDKKFTVKYPQNKDKLGKQP. | |
| Primary | |
| 55 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title