Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ZNF699 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
$482.50
Specifications
Antigen | ZNF699 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP191376
|
Novus Biologicals
NBP191376 |
100 μL |
Each of 1 for $482.50
|
|
|||||
Description
ZNF699 Polyclonal specifically detects ZNF699 in Human samples. It is validated for Western Blot.Specifications
ZNF699 | |
Polyclonal | |
Rabbit | |
NP_940937 | |
374879 | |
Synthetic peptide directed towards the N terminal of human ZNF699. Peptide sequence EEDLQTVKRELIQGIFMGEHREGFETQLKTNESVASQDICGEKISNEQKI. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
FLJ38144, hang, hangover homolog, hangover, Drosophila, homolog of, MGC129880, MGC129881, zinc finger protein 699 | |
ZNF699 | |
IgG | |
74 kDa |
Spot an opportunity for improvement?
Provide Content Correction
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title