Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ZNF778 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
Antigen | ZNF778 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
---|---|---|---|---|---|---|---|---|---|
Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
NBP180436
|
Novus Biologicals
NBP180436 |
100 μL |
Each of 1 for $436.00
|
|
Description
ZNF778 Polyclonal specifically detects ZNF778 in Human samples. It is validated for Western Blot.Specifications
ZNF778 | |
Polyclonal | |
Rabbit | |
Human | |
FLJ31875, MGC150573, zinc finger protein 778 | |
ZNF778 | |
IgG | |
Affinity Purified |
Western Blot | |
Unconjugated | |
RUO | |
NP_872337 | |
197320 | |
Synthetic peptide directed towards the N terminal of human ZNF778. Peptide sequence MAAPDLAHGGHVSRDSVCLHEEQTQAAGMVAGWLINCYQDAVTFDDVAVD. | |
Primary | |
Store at -20C. Avoid freeze-thaw cycles. |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title