Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ZNF781 Rabbit anti-Human, Polyclonal, Novus Biologicals™
Rabbit Polyclonal Antibody
$436.00
Specifications
| Antigen | ZNF781 |
|---|---|
| Applications | Western Blot |
| Classification | Polyclonal |
| Conjugate | Unconjugated |
| Host Species | Rabbit |
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|---|---|---|---|---|---|---|---|---|---|
| Catalog Number | Mfr. No. | Quantity | Price | Quantity & Availability | |||||
|
NBP179421
|
Novus Biologicals
NBP179421 |
100 μL |
Each of 1 for $436.00
|
|
|||||
Description
ZNF781 Polyclonal specifically detects ZNF781 in Human samples. It is validated for Western Blot.Specifications
| ZNF781 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| NP_689818 | |
| 163115 | |
| Synthetic peptide directed towards the N terminal of human ZNF781The immunogen for this antibody is ZNF781. Peptide sequence QRNAMYLKNVAETACNFQLTQYQISHANQKPYECQICGKPFRKRAHLTQH. | |
| Primary | |
| Store at -20C. Avoid freeze-thaw cycles. |
| Western Blot | |
| Unconjugated | |
| RUO | |
| PBS and 2% Sucrose with 0.09% Sodium Azide | |
| FLJ37549, MGC131783, zinc finger protein 781 | |
| ZNF781 | |
| IgG | |
| Affinity Purified | |
| 38kDa |
Provide Content Correction
We continue to work to improve your shopping experience and your feedback regarding this content is very important to us. Please use the form below to provide feedback related to the content on this product.
Product Title