Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ZNF791 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | ZNF791 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
ZNF791 Polyclonal specifically detects ZNF791 in Human samples. It is validated for Western Blot.Specifications
ZNF791 | |
Polyclonal | |
Rabbit | |
NP_699189 | |
163049 | |
Synthetic peptide directed towards the middle region of human ZNF791. Peptide sequence: CKECGKAFSLHSSFQRHTRIHNYEKPLECKQCGKAFSVSTSLKKHMRMHN | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
FLJ90396, MGC126179, MGC126180, zinc finger protein 791 | |
ZNF791 | |
IgG |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title