Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
                
Learn More
Learn More
                                ZNF829 Antibody, Novus Biologicals™
                                
                                
                                
                                
                            
                            
                            
                                
                                    
Rabbit Polyclonal Antibody
$382.00 - $728.30
Specifications
| Antigen | ZNF829 | 
|---|---|
| Applications | Immunocytochemistry, Immunofluorescence | 
| Classification | Polyclonal | 
| Conjugate | Unconjugated | 
| Host Species | Rabbit | 
Description
ZNF829 Polyclonal specifically detects ZNF829 in Human samples. It is validated for Immunocytochemistry/Immunofluorescence.Specifications
| ZNF829 | |
| Polyclonal | |
| Rabbit | |
| Human | |
| 374899 | |
| This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LSLKKRHFSQVIITREDMSTFIQPTFLIPPQKTMSEEKPWECK | |
| Primary | |
| Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins. | 
| Immunocytochemistry, Immunofluorescence | |
| Unconjugated | |
| RUO | |
| Zinc Finger Protein 829 | |
| ZNF829 | |
| IgG | |
| Affinity Purified | 
For Research Use Only
Spot an opportunity for improvement?Share a Content Correction
            
                    Product Content Correction
                
                Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title