Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
Learn More
ZNF835 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody
$487.50
Specifications
Antigen | ZNF835 |
---|---|
Applications | Western Blot |
Classification | Polyclonal |
Conjugate | Unconjugated |
Host Species | Rabbit |
Description
ZNF835 Polyclonal specifically detects ZNF835 in Human samples. It is validated for Western Blot.Specifications
ZNF835 | |
Polyclonal | |
Rabbit | |
XP_032059 | |
90485 | |
Synthetic peptide directed towards the middle region of human BC37295_3. Peptide sequence YTCQDCGALFSQSASLAEHRRIHTGEKPYACGQCAKAFTQVSHLTQHQRT. | |
Primary |
Western Blot | |
Unconjugated | |
RUO | |
BC37295_3, zinc finger protein 835 | |
ZNF835 | |
IgG | |
65 kDa |
Spot an opportunity for improvement?Share a Content Correction
Product Content Correction
Your input is important to us. Please complete this form to provide feedback related to the content on this product.
Product Title