Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. ZNF93 Antibody, Novus Biologicals™

ZNF93 Antibody, Novus Biologicals™
SDP

Catalog No. NBP17926020 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
20 μL
2 product options available for selection
Product selection table with 2 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NBP17926020 20 μL
NBP179260 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 2 options available.
2 options
Catalog No. NBP17926020 Supplier Novus Biologicals Supplier No. NBP17926020UL

Description

Rabbit Polyclonal Antibody

ZNF93 Polyclonal specifically detects ZNF93 in Human samples. It is validated for Western Blot.

Specifications

Antigen ZNF93
Applications Western Blot
Classification Polyclonal
Conjugate Unconjugated
Dilution Western Blot 1:1000
Formulation PBS and 2% Sucrose with 0.09% Sodium Azide
Gene Accession No. NP_112495
Gene Alias HPF34, HTF34, TF34, zinc finger protein 505, zinc finger protein 93, zinc finger protein HTF34, ZNF505
Gene Symbols ZNF93
Host Species Rabbit
Immunogen Synthetic peptide directed towards the N terminal of human ZNF93The immunogen for this antibody is ZNF93. Peptide sequence FNQFSTLITHKKIHTGEKPYICEECGKAFKYSSALNTHKRIHTGEKPYKC.
Purification Method Affinity Purified
Quantity 20 μL
Regulatory Status RUO
Primary or Secondary Primary
Gene ID (Entrez) 81931
Target Species Human
Content And Storage Store at -20C. Avoid freeze-thaw cycles.
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.