Promotional price valid on web orders only. Your contract pricing may differ. Interested in signing up for a dedicated account number?
Learn More
  1. Home
  2. Products
  3. Antibodies
  4. Primary Antibodies
  5. All Primary Antibodies
  6. NB301193

ZnT-8/SLC30A8 Antibody, Novus Biologicals™
SDP

Catalog No. NB301193 Shop All R&D Systems Products
Change view
Click to view available options
Quantity:
100 μL
1 product options available for selection
Product selection table with 1 available options. Use arrow keys to navigate and Enter or Space to select.
Catalog No. Quantity
NB301193 100 μL
Use arrow keys to navigate between rows. Press Enter or Space to select a product option. 1 options available.
1 options
Catalog No. NB301193 Supplier Novus Biologicals Supplier No. NBP325259
Only null left
Add to Cart
Add to Cart

Description

Rabbit Polyclonal Antibody

ZnT-8/SLC30A8 Polyclonal antibody specifically detects ZnT-8/SLC30A8 in Human samples. It is validated for Immunocytochemistry/ Immunofluorescence

Specifications

Antigen ZnT-8/SLC30A8
Applications Immunocytochemistry
Classification Polyclonal
Conjugate Unconjugated
Dilution Immunocytochemistry/Immunofluorescence 0.25 to 2 μg/mL
Formulation PBS, pH 7.2, 40% glycerol
Gene Alias solute carrier family 30 (zinc transporter), member 8, Solute carrier family 30 member 8, zinc transporter 8, zinc transporter ZnT-8, ZNT8ZnT-8
Host Species Rabbit
Immunogen This antibody has been engineered to specifically recognize the recombinant protein ZnT-8/SLC30A8 using the following amino acid sequence: LSAHVATAASRDSQVVRREIAKALSKSFTMHSLTIQMESPVDQDPDCLFCEDPCD
Purification Method Affinity purified
Quantity 100 μL
Regulatory Status RUO
Research Discipline Cancer, Endocrinology, Signal Transduction
Primary or Secondary Primary
Gene ID (Entrez) 169026
Target Species Human
Content And Storage Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Form Purified
Isotype IgG
Show More Show Less
Product Title
Select an issue

By clicking Submit, you acknowledge that you may be contacted by Fisher Scientific in regards to the feedback you have provided in this form. We will not share your information for any other purposes. All contact information provided shall also be maintained in accordance with our Privacy Policy.