ZnT-8/SLC30A8 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Supplier:  Novus Biologicals NBP26270125UL

Catalog No. NB393035

Description

ZnT-8/SLC30A8 Polyclonal antibody specifically detects ZnT-8/SLC30A8 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry (Paraffin)

Specifications

• Antigen: ZnT-8/SLC30A8
• Classification: Polyclonal
• Dilution: Immunohistochemistry 1:2500 - 1:5000, Immunohistochemistry-Paraffin 1:2500 - 1:5000
• Gene Alias: solute carrier family 30 (zinc transporter), member 8, Solute carrier family 30 member 8, zinc transporter 8, zinc transporter ZnT-8, ZNT8ZnT-8
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: LSAHVATAASRDSQVVRREIAKALSKSFTMHSLTIQMESPVDQDPDCLFCEDPCD
• Quantity: 25 μL
• Research Discipline: Cancer, Endocrinology, Signal Transduction
• Gene ID (Entrez): 169026
• Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
• Isotype: IgG

• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Formulation: PBS (pH 7.2) and 40% Glycerol
• Host Species: Rabbit
• Purification Method: Protein A purified
• Regulatory Status: RUO
• Primary or Secondary: Primary
• Target Species: Human
• Form: Purified