ZPBP2 Antibody, Novus Biologicals™

Rabbit Polyclonal Antibody

Catalog Number	Mfr. No.	Quantity
NB397371	Novus Biologicals NBP23367125UL	25 μL
NBP233671	Novus Biologicals NBP233671	0.1 mL

Description

ZPBP2 Polyclonal specifically detects ZPBP2 in Human samples. It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.

Specifications

• Antigen: ZPBP2
• Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
• Conjugate: Unconjugated
• Regulatory Status: RUO
• Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
• Gene Alias: CAAX prenyl protease 1 homolog, EC 3.4.24.84, FACE1FLJ14968, FACE-1zinc metalloproteinase (STE24 homolog, yeast), Farnesylated proteins-converting enzyme 1, farnesylated-proteins converting enzyme 1, HGPS, Hutchinson-Gilford progeria syndrome, MADB, Prenyl protein-specific endoprotease 1, PRO1, Ste24p, STE24zinc metallopeptidase (STE24 homolog, yeast), zinc metallopeptidase (STE24 homolog, S. cerevisiae), Zinc metalloproteinase Ste24 homolog
• Gene Symbols: ZPBP2
• Isotype: IgG
• Purification Method: Affinity Purified
• Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.

• Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500
• Classification: Polyclonal
• Host Species: Rabbit
• Target Species: Human
• Gene Accession No.: Q6X784
• Gene ID (Entrez): 124626
• Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: VELHQNSPVLICMDFKLSKKEIVDPTYLWIGPNEKTLTGNNRINITETGQLMVKDFLEPLSGLYTCTLSYKTVKAETQ
• Primary or Secondary: Primary
• Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.

For Research Use Only